McDonnell Genome Institute

Washington University

Transcript

lnc-RC3H1-1:5

Chromosome

chr1

Gene Name

lnc-RC3H1-1

Start

174114782

CPC Label

noncoding

End

174159661

Cancer

OV

Strand

-

Peptide

RSEVLTEPELLEQGR

Modified Peptide

n[145]RSEVLTEPELLEQGR

Peptide Length

15

ORF Length

79

Open Reading Frame (ORF)

LRRERRSEVLTEPELLEQGRAKGGSTGGAGEPPRRRGLGVGPRPRARPDRGVCVLVKRSLVSSFCETRGRLKREITCGE

Conservation Score

0.447

PhyloCSF Frame 1

-2.686

No. of Spectra

1

CPC Coding Probability

0.00865877

PhyloCSF Frame 2 

-2.107

CNTI Index

noncoding

Max Probability

0.1409

PhyloCSF Frame 3

-3.305

CNTI Score

-0.318423098