McDonnell Genome Institute

Washington University

Transcript

lnc-RBMY1B-1:5

Chromosome

chrY

Gene Name

lnc-RBMY1B-1

Start

21151475

CPC Label

noncoding

End

21152928

Cancer

OV

Strand

+

Peptide

QVLTAAK

Modified Peptide

n[145]QVLTAAK

Peptide Length

7

ORF Length

64

Open Reading Frame (ORF)

LSILFAFFIIVLKISLLLPYKQVLTAAKKNKHTGKKFSQQECQGERKDQLDQSTSAAPVTWQST

Conservation Score

0.122

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0000174

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5997

PhyloCSF Frame 3

0

CNTI Score

-0.428040169