McDonnell Genome Institute

Washington University

Transcript

lnc-RBMY1B-1:1

Chromosome

chrY

Gene Name

lnc-RBMY1B-1

Start

21138787

CPC Label

noncoding

End

21170175

Cancer

CCRC

Strand

+

Peptide

LARMQHILIHWLGRR

Modified Peptide

LARM[147]QHILIHWLGRR

Peptide Length

15

ORF Length

94

Open Reading Frame (ORF)

LARMQHILIHWLGRREFIRRVYPMLLEPQEETSLPNSQCSLLQRRTSTQAKSFPSKNARVKGKINWTRAQVLLQLLGRVPNSDPPQYHHISVWE

Conservation Score

0.124

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.150275

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9017

PhyloCSF Frame 3

0

CNTI Score

-0.386128295