McDonnell Genome Institute

Washington University

Transcript

lnc-RBMX-6:1

Chromosome

chrX

Gene Name

lnc-RBMX-6

Start

136947747

CPC Label

noncoding

End

136948133

Cancer

OV

Strand

-

Peptide

ITVTSEVLFTKRYFK

Modified Peptide

n[145]ITVTSEVLFTKRYFK

Peptide Length

15

ORF Length

73

Open Reading Frame (ORF)

LHPLCRRWNHDTANFVQFLQERIKVSRKAESLGGGGMTIKISKSKITVTSEVLFTKRYFKYLTKKYLKKKSPT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0299081

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4864

PhyloCSF Frame 3

0

CNTI Score

-0.401235961