McDonnell Genome Institute

Washington University

Transcript

lnc-RBMS2-4:1

Chromosome

chr12

Gene Name

lnc-RBMS2-4

Start

56510780

CPC Label

coding

End

56513130

Cancer

LUAD

Strand

+

Peptide

KISSVQSVVPALEIANAHR

Modified Peptide

KISSVQSVVPALEIANAHR

Peptide Length

19

ORF Length

448

Open Reading Frame (ORF)

MLRLPTVFRQMRLVSRVLAPHLTGAYAKDVKFGADARALMLQGIDLLADAVALTMGPKGRRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEETGDGPTTATVLARSIAKEGIEKISKGANPVEIRRGVMLVVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNISDAMKKVGRKGVITVKDGKTLNDELEIIEGIKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSVVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQDVAIKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGNVGEVIVTKDDATLLKEKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDVVAVLKVGGTSDVEVNEKKDRVRMPLMLQELLLKKALYWEGVVPCFDAF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

1

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7812

PhyloCSF Frame 3

0

CNTI Score

0.801850511