McDonnell Genome Institute

Washington University

Transcript

lnc-RBMS2-2:1

Chromosome

chr12

Gene Name

lnc-RBMS2-2

Start

56752456

CPC Label

noncoding

End

56770544

Cancer

OV

Strand

+

Peptide

ETQQFAICPRVR

Modified Peptide

n[145]ETQQFAICPRVR

Peptide Length

12

ORF Length

37

Open Reading Frame (ORF)

LRETQQFAICPRVRALGPPLLWAEGRVHSRKRIFSGN

Conservation Score

0.007

PhyloCSF Frame 1

-5.547

No. of Spectra

8

CPC Coding Probability

0.0167403

PhyloCSF Frame 2 

-3.909

CNTI Index

noncoding

Max Probability

0.7979

PhyloCSF Frame 3

-4.714

CNTI Score

-0.345633507