McDonnell Genome Institute

Washington University

Transcript

lnc-RBMS1-7:1

Chromosome

chr2

Gene Name

lnc-RBMS1-7

Start

161048605

CPC Label

noncoding

End

161050546

Cancer

EOGC

Strand

-

Peptide

DLNERGHALLSFCPEELGFVCYLK

Modified Peptide

n[145]DLNERGHALLSFCPEELGFVCYLK

Peptide Length

24

ORF Length

188

Open Reading Frame (ORF)

LCTDEAGRELDIPGWIVQYYPPDDPKEYVHRRGTIARDLNERGHALLSFCPEELGFVCYLKQPKVPLSEFDFSWPKISDIQSWFVKLMKKNYFLHKSAQEAYKSYIRVNDSHSLRQIFNVNNLNLPQVALSFGFKVPPSVDVNVNSNEGKHKKRGGESRFSYQKTKKVKSIIFKNISTKSSDSRQFCH

Conservation Score

1

PhyloCSF Frame 1

-4.232

No. of Spectra

2

CPC Coding Probability

0.183862

PhyloCSF Frame 2 

-4.099

CNTI Index

coding

Max Probability

0.4195

PhyloCSF Frame 3

-4.158

CNTI Score

0.543768853