McDonnell Genome Institute

Washington University

Transcript

lnc-RBM6-4:1

Chromosome

chr3

Gene Name

lnc-RBM6-4

Start

49903844

CPC Label

noncoding

End

49906237

Cancer

OV

Strand

+

Peptide

AESGRGGGAAR

Modified Peptide

n[145]AESGRGGGAAR

Peptide Length

11

ORF Length

109

Open Reading Frame (ORF)

LALSAQPTRGRRAGRAESGRGGGAARKAWPSPGPPPIRLFRPLEAWLLYLHLASWRLFLSGLWVDVHGVAWRECRTPPPSSLELHEHLKTERGNGSGGGHTQCRVDTVP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0133268

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1208

PhyloCSF Frame 3

0.015

CNTI Score

-0.3072238