McDonnell Genome Institute

Washington University

Transcript

lnc-RBM4B-3:1

Chromosome

chr11

Gene Name

lnc-RBM4B-3

Start

66718443

CPC Label

noncoding

End

66718711

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

VHGNGLHEASEFYYEAVEGAHNPGGLLLSPAAFINPAQYASVLEGR

Modified Peptide

n[145]VHGNGLHEASEFYYEAVEGAHNPGGLLLSPAAFINPAQYASVLEGR

Peptide Length

46

ORF Length

59

Open Reading Frame (ORF)

MNGNGVSRVHGNGLHEASEFYYEAVEGAHNPGGLLLSPAAFINPAQYASVLEGRFKQLQ

Conservation Score

1

PhyloCSF Frame 1

-2.048

No. of Spectra

1

CPC Coding Probability

0.0263303

PhyloCSF Frame 2 

10.937

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-3.509

CNTI Score

-0.322163813