McDonnell Genome Institute

Washington University

Transcript

lnc-RBM47-1:1

Chromosome

chr4

Gene Name

lnc-RBM47-1

Start

40688949

CPC Label

noncoding

End

40694696

Cancer

BRCA-Luminal A

Strand

-

Peptide

IVMLEYNVMK

Modified Peptide

n[145]IVMLEYNVMK

Peptide Length

10

ORF Length

35

Open Reading Frame (ORF)

LPQKKKKIQKLKKKIVMLEYNVMKENVIMLVEEYE

Conservation Score

0.99

PhyloCSF Frame 1

-5.53

No. of Spectra

8

CPC Coding Probability

0.0127646

PhyloCSF Frame 2 

-4.927

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-5.854

CNTI Score

-0.3675917