McDonnell Genome Institute

Washington University

Transcript

lnc-RBM46-2:1

Chromosome

chr4

Gene Name

lnc-RBM46-2

Start

154724585

CPC Label

noncoding

End

154724880

Cancer

HCC

Strand

+

Peptide

LVLEAASSK

Modified Peptide

n[43]LVLEAASSK

Peptide Length

9

ORF Length

40

Open Reading Frame (ORF)

LVLEAASSKVAAQVAGGGTVCRMGGGVHIQFPQLTRSQVI

Conservation Score

1

PhyloCSF Frame 1

-5.012

No. of Spectra

1

CPC Coding Probability

0.0264076

PhyloCSF Frame 2 

-3.674

CNTI Index

noncoding

Max Probability

0.4303

PhyloCSF Frame 3

-2.559

CNTI Score

-0.367102366