McDonnell Genome Institute

Washington University

Transcript

lnc-RBM45-3:1

Chromosome

chr2

Gene Name

lnc-RBM45-3

Start

178247021

CPC Label

noncoding

End

178248013

Cancer

LUAD

Strand

+

Peptide

FVVFSVPK

Modified Peptide

n[230]FVVFSVPK

Peptide Length

8

ORF Length

33

Open Reading Frame (ORF)

LKFVVFSVPKNAEQLESFEDTCPLLDYVVFWEG

Conservation Score

0.514

PhyloCSF Frame 1

-4.82

No. of Spectra

11

CPC Coding Probability

0.133553

PhyloCSF Frame 2 

-2.237

CNTI Index

noncoding

Max Probability

0.9413

PhyloCSF Frame 3

-4.869

CNTI Score

-0.413074278