McDonnell Genome Institute

Washington University

Transcript

lnc-RBM33-3:2

Chromosome

chr7

Gene Name

lnc-RBM33-3

Start

155886832

CPC Label

noncoding

End

155902628

Cancer

OV

Strand

+

Peptide

FELGSNSELPGK

Modified Peptide

n[145]FELGSNSELPGK

Peptide Length

12

ORF Length

93

Open Reading Frame (ORF)

LSAEWGAHGQPHRAVGSIKVAVAVSLSVLSGPQATPAKLLLPPKRFELGSNSELPGKGGIKRPPFQAFALIKLSCDLSMTLGRGATGVMTVTS

Conservation Score

0.022

PhyloCSF Frame 1

-4.154

No. of Spectra

1

CPC Coding Probability

0.183485

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.33

PhyloCSF Frame 3

-4.103

CNTI Score

-0.334168183