McDonnell Genome Institute

Washington University

Transcript

lnc-RBM28-3:1

Chromosome

chr7

Gene Name

lnc-RBM28-3

Start

128297684

CPC Label

coding

End

128307763

Cancer

OSCC

Strand

-

Peptide

QALGVERCEEMAPR

Modified Peptide

n[145]QALGVERCEEMAPR

Peptide Length

14

ORF Length

104

Open Reading Frame (ORF)

LANFHFFPARDGNTRQNPGKATCPQVVLAPPPASAGIPGYEPGSAPGVTHPPQCPFFPHNCRQKESVSCLSEELAVPFKQALGVERCEEMAPRSLFLLFQSKHC

Conservation Score

0.178

PhyloCSF Frame 1

-4.508

No. of Spectra

1

CPC Coding Probability

0.588017

PhyloCSF Frame 2 

-5.15

CNTI Index

noncoding

Max Probability

0.2547

PhyloCSF Frame 3

-3.995

CNTI Score

-0.305608653