McDonnell Genome Institute

Washington University

Transcript

lnc-RBM23-3:1

Chromosome

chr14

Gene Name

lnc-RBM23-3

Start

22861354

CPC Label

noncoding

End

22872609

Cancer

CCRC

Strand

-

Peptide

LLNLSVLLR

Modified Peptide

n[230]LLNLSVLLR

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

LLAVTSRKLLNLSVLLRYKMRLMIVQLPLKVVANI

Conservation Score

0.991

PhyloCSF Frame 1

-5.249

No. of Spectra

16

CPC Coding Probability

0.153218

PhyloCSF Frame 2 

-5.669

CNTI Index

coding

Max Probability

0.9996

PhyloCSF Frame 3

-3.962

CNTI Score

0.685947787