McDonnell Genome Institute

Washington University

Transcript

lnc-RBM19-2:1

Chromosome

chr12

Gene Name

lnc-RBM19-2

Start

113816737

CPC Label

noncoding

End

113818179

Cancer

HCC

Strand

-

Peptide

LCSAASR

Modified Peptide

n[230]LCSAASR

Peptide Length

7

ORF Length

97

Open Reading Frame (ORF)

LLGICCVRDTVLGAPDTRQKLGSLCVPPHWPSLLRGRRLCLLGFKPHASGGRQFPAASARLFFLLSFSCRLGLFCLLCRAVSRSARLCSAASRKGLV

Conservation Score

1

PhyloCSF Frame 1

-1.286

No. of Spectra

29

CPC Coding Probability

0.303831

PhyloCSF Frame 2 

-2.518

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.333511063