McDonnell Genome Institute

Washington University

Transcript

lnc-RBM12B-5:1

Chromosome

chr8

Gene Name

lnc-RBM12B-5

Start

93752527

CPC Label

noncoding

End

93769662

Cancer

LUAD

Strand

-

Peptide

VVGAAPR

Modified Peptide

n[230]VVGAAPR

Peptide Length

7

ORF Length

154

Open Reading Frame (ORF)

LATRNQSEKQLQHDFKSGIPNLSLGKNQCSELVCLAHNCCGDVMLSLARSEPRQMRDRHSWQMEPLFSFLWAPRLSSLPLGSMWDAGIWNPADLASSTLCLMASAGLGGPLRQQVPLARLLWPLPCRQPFFKVVGAAPRAHQAALPCPRQCWFC

Conservation Score

0.232

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.339608

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

0

CNTI Score

-0.343832891