McDonnell Genome Institute

Washington University

Transcript

lnc-RBM12B-4:2

Chromosome

chr8

Gene Name

lnc-RBM12B-4

Start

93715352

CPC Label

noncoding

End

93722380

Cancer

BRCA-Basal-like

Strand

-

Peptide

TDESLIIK

Modified Peptide

n[145]TDESLIIK

Peptide Length

8

ORF Length

85

Open Reading Frame (ORF)

MTDESLIIKFFFLDGVSLCCQARVQWHDLGSLQTLTPGFKRFFCLSLPSSWDYRRVPPSLANFCIFSRDGVSPCWPGWSRTPDLR

Conservation Score

0.845

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.0584372

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.351842815