McDonnell Genome Institute

Washington University

Transcript

lnc-RBM12B-2:4

Chromosome

chr8

Gene Name

lnc-RBM12B-2

Start

93882511

CPC Label

noncoding

End

93916639

Cancer

OV

Strand

-

Peptide

KTETQEVK

Modified Peptide

n[145]KTETQEVK

Peptide Length

8

ORF Length

131

Open Reading Frame (ORF)

LRKRLLYPSYHHTNCYTHHTHKKTETQEVKYWSEWQSWNSKQALEAKHWHFCTHLGGELVAGSREASSGRPGLGCPRLTPTLSNPEECRHSGYCKGRRRKPTQTSEKAGAEQERGNGIQFGEVQTKLATQS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0636459

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9361

PhyloCSF Frame 3

0

CNTI Score

-0.331489473