McDonnell Genome Institute

Washington University

Transcript

lnc-RBM12B-2:3

Chromosome

chr8

Gene Name

lnc-RBM12B-2

Start

93863187

CPC Label

noncoding

End

93916639

Cancer

OV

Strand

-

Peptide

LFTGYLPSLSLEGPDSYALVGSFR

Modified Peptide

n[145]LFTGYLPSLSLEGPDSYALVGSFR

Peptide Length

24

ORF Length

33

Open Reading Frame (ORF)

LFTGYLPSLSLEGPDSYALVGSFRFLETKGIYT

Conservation Score

0.027

PhyloCSF Frame 1

-4.524

No. of Spectra

4

CPC Coding Probability

0.0503498

PhyloCSF Frame 2 

-3.308

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-5.951

CNTI Score

-0.306324599