McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-8:1

Chromosome

chr21

Gene Name

lnc-RBM11-8

Start

14000926

CPC Label

noncoding

End

14005279

Cancer

BRCA-Basal-like

Strand

+

Peptide

LFLDSLWK

Modified Peptide

n[145]LFLDSLWK

Peptide Length

8

ORF Length

96

Open Reading Frame (ORF)

LFLDSLWKALAGHGGSRQLTQSSAIACAKLCKASTYINWEDNAVIFLLVQSMVVDLTNLLFNPSKPFSRGSQPADVDLMIDCLVSCLRVSPHNNQV

Conservation Score

1

PhyloCSF Frame 1

-3.557

No. of Spectra

1

CPC Coding Probability

0.042236

PhyloCSF Frame 2 

4.189

CNTI Index

noncoding

Max Probability

0.8144

PhyloCSF Frame 3

-3.858

CNTI Score

-0.414029088