McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-5:5

Chromosome

chr21

Gene Name

lnc-RBM11-5

Start

14273879

CPC Label

coding

End

14299685

Cancer

PRAD

Strand

+

Peptide

WIFQLQER

Modified Peptide

Peptide Length

8

ORF Length

35

Open Reading Frame (ORF)

LTSTGRRRWIFQLQERELIHSLFTFLFYPGPQQIG

Conservation Score

0.027

PhyloCSF Frame 1

-4.243

No. of Spectra

32

CPC Coding Probability

0.511999

PhyloCSF Frame 2 

-4.795

CNTI Index

coding

Max Probability

0.9977

PhyloCSF Frame 3

-5.473

CNTI Score

0.646055239