McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-5:4

Chromosome

chr21

Gene Name

lnc-RBM11-5

Start

14273798

CPC Label

coding

End

14291385

Cancer

OV

Strand

+

Peptide

VFADILSFTSPLIMNYTRK

Modified Peptide

n[145]VFADILSFTSPLIM[147]NYTRK

Peptide Length

19

ORF Length

192

Open Reading Frame (ORF)

LSAAKGSDSRSRALSQRPGAPRTMLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTACPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMNYTRKVNYLMGLPCENQKITSYSQASGRDS

Conservation Score

1

PhyloCSF Frame 1

2.71

No. of Spectra

1

CPC Coding Probability

0.619981

PhyloCSF Frame 2 

-2.536

CNTI Index

noncoding

Max Probability

0.8043

PhyloCSF Frame 3

-1.067

CNTI Score

-0.305324474