McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-5:2

Chromosome

chr21

Gene Name

lnc-RBM11-5

Start

14273798

CPC Label

coding

End

14338017

Cancer

BRCA-Luminal B

Strand

+

Peptide

IDMQVLR

Modified Peptide

n[145]IDMQVLR

Peptide Length

7

ORF Length

124

Open Reading Frame (ORF)

LPDFLKQHFTEVEVTRIDMQVLRDRPSLDQGKQLSMKKEKIPVGGLKFSIILQYLQAFGWLWVWLTVVTYLGQNLVSIGQNLWLSAWAKEAKNMNEFTEWKQIRSNKLNIYGLLGLIKGKRKCK

Conservation Score

1

PhyloCSF Frame 1

3.753

No. of Spectra

3

CPC Coding Probability

0.999756

PhyloCSF Frame 2 

-3.15

CNTI Index

coding

Max Probability

0.8948

PhyloCSF Frame 3

-4.501

CNTI Score

0.65993131