McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-4:5

Chromosome

chr21

Gene Name

lnc-RBM11-4

Start

14915090

CPC Label

noncoding

End

14920104

Cancer

OV

Strand

+

Peptide

ALGEMNFPHQR

Modified Peptide

n[145]ALGEMNFPHQR

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

MRKRNNFYVSGRREKLFPRALGEMNFPHQRWSRLKNR

Conservation Score

1

PhyloCSF Frame 1

-5.337

No. of Spectra

2

CPC Coding Probability

0.105972

PhyloCSF Frame 2 

-4.528

CNTI Index

noncoding

Max Probability

0.7325

PhyloCSF Frame 3

-6.037

CNTI Score

-0.392829098