McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-2:10

Chromosome

chr21

Gene Name

lnc-RBM11-2

Start

14027442

CPC Label

coding

End

14106111

Cancer

OSCC

Strand

+

Peptide

EGLPSAFAESENVITATVEGR

Modified Peptide

n[145]EGLPSAFAESENVITATVEGR

Peptide Length

21

ORF Length

65

Open Reading Frame (ORF)

LSKTPSQKKKKKEGLPSAFAESENVITATVEGRAQGKEGGGPKAGGTIAHPGIFSSLVGTTLETS

Conservation Score

0.176

PhyloCSF Frame 1

0

No. of Spectra

27

CPC Coding Probability

0.918742

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.289256609