McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-16:1

Chromosome

chr21

Gene Name

lnc-RBM11-16

Start

14908021

CPC Label

noncoding

End

14912890

Cancer

LUAD

Strand

+

Peptide

AQILSPSHMAATRQCGR

Modified Peptide

n[230]AQILSPSHM[147]AATRQCGR

Peptide Length

17

ORF Length

84

Open Reading Frame (ORF)

LPPFAFCYNRVALSSSAKSHNQCILPPQRAQILSPSHMAATRQCGRSGIGNSRLPFQDTTKKENFRPISLMNINVKILNKILAN

Conservation Score

0.576

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.13209

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1803

PhyloCSF Frame 3

0

CNTI Score

-0.351256786