McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-15:2

Chromosome

chr21

Gene Name

lnc-RBM11-15

Start

14864567

CPC Label

noncoding

End

14880553

Cancer

BRCA-Luminal B

Strand

+

Peptide

IYNEHVYNK

Modified Peptide

n[145]IYNEHVYNK

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LLPTLIIFVKILIREYLSTENGKSLEIKIYNEHVYNKYFSLMSVSTVSFKFKRLCDHF

Conservation Score

0.877

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.132662

PhyloCSF Frame 2 

-4.541

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.331420391