McDonnell Genome Institute

Washington University

Transcript

lnc-RBM11-1:5

Chromosome

chr21

Gene Name

lnc-RBM11-1

Start

14383480

CPC Label

noncoding

End

14394974

Cancer

OSCC

Strand

+

Peptide

SFVVLVFAVYSLPTTVLNTLWMLK

Modified Peptide

n[145]SFVVLVFAVYSLPTTVLNTLWM[147]LK

Peptide Length

24

ORF Length

34

Open Reading Frame (ORF)

MGHHGRRSFVVLVFAVYSLPTTVLNTLWMLKYIK

Conservation Score

0.685

PhyloCSF Frame 1

-5.873

No. of Spectra

7

CPC Coding Probability

0.022135

PhyloCSF Frame 2 

-4.276

CNTI Index

noncoding

Max Probability

0.4698

PhyloCSF Frame 3

-4.263

CNTI Score

-0.460637743