McDonnell Genome Institute

Washington University

Transcript

lnc-RBL2-1:6

Chromosome

chr16

Gene Name

lnc-RBL2-1

Start

53384167

CPC Label

noncoding

End

53392715

Cancer

LUAD

Strand

+

Peptide

LLFFFQK

Modified Peptide

n[43]LLFFFQK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

MLLFFFQKGNTSLFTYPSVIPACDLEHVAVHGFSLYFYYC

Conservation Score

0.034

PhyloCSF Frame 1

0

No. of Spectra

38

CPC Coding Probability

0.0420813

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.328348306