McDonnell Genome Institute

Washington University

Transcript

lnc-RBKS-8:2

Chromosome

chr2

Gene Name

lnc-RBKS-8

Start

28357507

CPC Label

noncoding

End

28360507

Cancer

OV

Strand

-

Peptide

AGHGGSLCNPSTLR

Modified Peptide

n[145]AGHGGSLCNPSTLR

Peptide Length

14

ORF Length

62

Open Reading Frame (ORF)

LSQKKKKKKKAGHGGSLCNPSTLRGRVSWITRSGDRDHPGQHGETLSLLNYKKLAGHGGRCL

Conservation Score

0.023

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.36803

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9729

PhyloCSF Frame 3

0

CNTI Score

-0.294533317