McDonnell Genome Institute

Washington University

Transcript

lnc-RBFOX1-1:1

Chromosome

chr16

Gene Name

lnc-RBFOX1-1

Start

8098848

CPC Label

noncoding

End

8099731

Cancer

BRCA-Luminal A

Strand

+

Peptide

SWSVEPEAEREENREIK

Modified Peptide

n[145]SWSVEPEAEREENREIK

Peptide Length

17

ORF Length

94

Open Reading Frame (ORF)

LARFPRQGRNEKHDTEAFKGDLRGKQKLLDDTEAEKGKPELRGTACQPPDGLALLINRSWSVEPEAEREENREIKGRGEDTKGLAVVIAVWALD

Conservation Score

1

PhyloCSF Frame 1

2.91

No. of Spectra

2

CPC Coding Probability

0.0477852

PhyloCSF Frame 2 

-0.617

CNTI Index

noncoding

Max Probability

0.791

PhyloCSF Frame 3

-1.556

CNTI Score

-0.326352377