McDonnell Genome Institute

Washington University

Transcript

lnc-RBBP8NL-2:1

Chromosome

chr20

Gene Name

lnc-RBBP8NL-2

Start

62402235

CPC Label

noncoding

End

62405935

Cancer

OV

Strand

-

Peptide

GTEAQSFGR

Modified Peptide

n[145]GTEAQSFGR

Peptide Length

9

ORF Length

108

Open Reading Frame (ORF)

LLYLGLDEMGHPRPATHSTAVPQGPGDGAGGGRTKPLPTLGAGGSRTTPLPTPSWRETVPVSPVLAWARRGTEAQSFGRGSRLFSHCQTHRQGHFNGPFARPGLLSSL

Conservation Score

0.253

PhyloCSF Frame 1

-3.009

No. of Spectra

10

CPC Coding Probability

0.199869

PhyloCSF Frame 2 

-2.835

CNTI Index

noncoding

Max Probability

0.9143

PhyloCSF Frame 3

-4.752

CNTI Score

-0.30254251