McDonnell Genome Institute

Washington University

Transcript

lnc-RBBP7-2:1

Chromosome

chrX

Gene Name

lnc-RBBP7-2

Start

17099781

CPC Label

noncoding

End

17100239

Cancer

EOGC

Strand

-

Peptide

GFAQGLEPEQIIGATDSSGELMFLMK

Modified Peptide

n[145]GFAQGLEPEQIIGATDSSGELM[147]FLM[147]K

Peptide Length

26

ORF Length

113

Open Reading Frame (ORF)

LPSQKTAHEIDKSEGGKHKADSDSEDKGEESKPKKKKEESEKPRGFAQGLEPEQIIGATDSSGELMFLMKGKNSDEADLVPAKEVNVKCPRVVISFYEERLTWHSYPKEDDDK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0238913

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9163

PhyloCSF Frame 3

0

CNTI Score

0.698206507