McDonnell Genome Institute

Washington University

Transcript

lnc-RAVER2-3:1

Chromosome

chr1

Gene Name

lnc-RAVER2-3

Start

64941978

CPC Label

noncoding

End

64942365

Cancer

CCRC

Strand

+

Peptide

NYSWMNIITICK

Modified Peptide

n[230]NYSWM[147]NIITICK

Peptide Length

12

ORF Length

34

Open Reading Frame (ORF)

LTNTRTIQNYIKIQRERNYSWMNIITICKDKLPN

Conservation Score

1

PhyloCSF Frame 1

-5.377

No. of Spectra

6

CPC Coding Probability

0.0160011

PhyloCSF Frame 2 

-5.658

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

-5.316

CNTI Score

-0.416347213