McDonnell Genome Institute

Washington University

Transcript

lnc-RAVER2-2:1

Chromosome

chr1

Gene Name

lnc-RAVER2-2

Start

64918442

CPC Label

noncoding

End

64918683

Cancer

HCC

Strand

+

Peptide

KNDPGPWNK

Modified Peptide

KNDPGPWNK

Peptide Length

9

ORF Length

63

Open Reading Frame (ORF)

LYLMELEVPEQHCMSCIWHFNPDVSWARKNDPGPWNKLGSNEQYKFYSVNVDYSKLKKDGPDF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0245742

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9216

PhyloCSF Frame 3

0

CNTI Score

-0.417179266