McDonnell Genome Institute

Washington University

Transcript

lnc-RASSF9-2:1

Chromosome

chr12

Gene Name

lnc-RASSF9-2

Start

85421178

CPC Label

noncoding

End

85469634

Cancer

OV

Strand

-

Peptide

SLSSFWIQGQAK

Modified Peptide

n[145]SLSSFWIQGQAK

Peptide Length

12

ORF Length

75

Open Reading Frame (ORF)

MSLSSFWIQGQAKSCFLASLLLMCGHVLNSSQKKGSRNDMCYYQDWTMKTYYTFSSMYASLQVYQDGGLQGIEIC

Conservation Score

0.481

PhyloCSF Frame 1

-5.403

No. of Spectra

9

CPC Coding Probability

0.102072

PhyloCSF Frame 2 

-4.889

CNTI Index

noncoding

Max Probability

0.9532

PhyloCSF Frame 3

-4.939

CNTI Score

-0.38022826