McDonnell Genome Institute

Washington University

Transcript

lnc-RASSF8-2:1

Chromosome

chr12

Gene Name

lnc-RASSF8-2

Start

25803261

CPC Label

coding

End

25804302

Cancer

CCRC

Strand

+

Peptide

NLASLQNQK

Modified Peptide

NLASLQNQK

Peptide Length

9

ORF Length

66

Open Reading Frame (ORF)

MNSKCQKKFQPQLLLRNQCKRLQKEEKENPEQQNQNNQWNPKNLLSQKNLASLQNQKKSKKNYRHI

Conservation Score

1

PhyloCSF Frame 1

-3.036

No. of Spectra

4

CPC Coding Probability

0.607014

PhyloCSF Frame 2 

-4.102

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

-2.54

CNTI Score

-0.321498059