McDonnell Genome Institute

Washington University

Transcript

lnc-RASSF2-4:1

Chromosome

chr20

Gene Name

lnc-RASSF2-4

Start

4590992

CPC Label

noncoding

End

4591300

Cancer

EOGC

Strand

-

Peptide

YDEICCHWGGNVLGPKSVARITK

Modified Peptide

n[145]YDEICCHWGGNVLGPKSVARITK

Peptide Length

23

ORF Length

90

Open Reading Frame (ORF)

MGGPYCFIKGKSRLGLLVHKKRGTTAAFAQVNLEDKGALAKLVETIRTNYSDRYDEICCHWGGNVLGPKSVARITKLKKAKAKELATKLG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.489176

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6257

PhyloCSF Frame 3

0

CNTI Score

0.625082148