McDonnell Genome Institute

Washington University

Transcript

lnc-RASL11B-2:3

Chromosome

chr4

Gene Name

lnc-RASL11B-2

Start

52945688

CPC Label

noncoding

End

52958087

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

VGAAPGEQQGK

Modified Peptide

n[145]VGAAPGEQQGK

Peptide Length

11

ORF Length

84

Open Reading Frame (ORF)

MVGAAPGEQQGKRNRDETAGLELLKSWQNSICGQNETCLHNSGLQCFGELMWLGRLKAHKRGGQGDQRHPTIPETTLGFKCKCC

Conservation Score

0.389

PhyloCSF Frame 1

-4.353

No. of Spectra

1

CPC Coding Probability

0.207483

PhyloCSF Frame 2 

-3.685

CNTI Index

noncoding

Max Probability

0.9196

PhyloCSF Frame 3

-3.455

CNTI Score

-0.334951526