McDonnell Genome Institute

Washington University

Transcript

lnc-RASGRP4-1:1

Chromosome

chr19

Gene Name

lnc-RASGRP4-1

Start

38395074

CPC Label

noncoding

End

38402918

Cancer

OV

Strand

-

Peptide

HPRFSLTHPR

Modified Peptide

n[145]HPRFSLTHPR

Peptide Length

10

ORF Length

156

Open Reading Frame (ORF)

LPGSQGGPPCTPDLGAMKGNHGSEVGLSREQDWGTWERRCWEVAARGPFLSPHRFICRSHSTVQHSGPPSHPSPKRGRLRMELPPRPPWKGGDRGTERGMGTQAAPAPNPSALSSGGSDSDESWAEWGGERHPRFSLTHPRVWLGVLNLTGSGCNK

Conservation Score

1

PhyloCSF Frame 1

-3.202

No. of Spectra

1

CPC Coding Probability

0.191023

PhyloCSF Frame 2 

-2.964

CNTI Index

noncoding

Max Probability

0.121

PhyloCSF Frame 3

-3.951

CNTI Score

-0.254199429