McDonnell Genome Institute

Washington University

Transcript

lnc-RASGRP3-14:2

Chromosome

chr2

Gene Name

lnc-RASGRP3-14

Start

34563976

CPC Label

coding

End

34591042

Cancer

OSCC

Strand

+

Peptide

MLNLTISINMK

Modified Peptide

n[145]MLNLTISINM[147]K

Peptide Length

11

ORF Length

51

Open Reading Frame (ORF)

MLNLTISINMKTTVTSMCMVCVRYCLKMPSHCLDTKKQTHLNMISLFHSLC

Conservation Score

0.999

PhyloCSF Frame 1

-5.583

No. of Spectra

19

CPC Coding Probability

0.684587

PhyloCSF Frame 2 

-3.571

CNTI Index

noncoding

Max Probability

0.8571

PhyloCSF Frame 3

-5.251

CNTI Score

-0.394026873