McDonnell Genome Institute

Washington University

Transcript

lnc-RASEF-3:1

Chromosome

chr9

Gene Name

lnc-RASEF-3

Start

82562869

CPC Label

noncoding

End

82583832

Cancer

PRAD

Strand

-

Peptide

KKMTGACPVLFQTQK

Modified Peptide

KKM[147]TGACPVLFQTQK

Peptide Length

15

ORF Length

92

Open Reading Frame (ORF)

LKRKKMTGACPVLFQTQKQVTPWNQIKEGSKCMLHRAGSDPGRFDVPGNIPTLSWTDLEAHLRQHLHVHVSLTCLSSCLFELNRRNGRSLPK

Conservation Score

0.998

PhyloCSF Frame 1

-4.42

No. of Spectra

4

CPC Coding Probability

0.0887311

PhyloCSF Frame 2 

-5.317

CNTI Index

noncoding

Max Probability

0.5668

PhyloCSF Frame 3

-3.446

CNTI Score

-0.389944231