McDonnell Genome Institute

Washington University

Transcript

lnc-RASD2-1:1

Chromosome

chr22

Gene Name

lnc-RASD2-1

Start

35526931

CPC Label

noncoding

End

35527415

Cancer

OV

Strand

+

Peptide

VMSPDLR

Modified Peptide

n[145]VM[147]SPDLR

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

LLALGLAPPSRFGCSLHSAPQGPCTDRCESMYQNLLSQNTQGFGDQGPRVMSPDLRLLL

Conservation Score

0.021

PhyloCSF Frame 1

-3.984

No. of Spectra

7

CPC Coding Probability

0.0139961

PhyloCSF Frame 2 

-4.552

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-4.595

CNTI Score

-0.366060778