McDonnell Genome Institute

Washington University

Transcript

lnc-RASD1-1:2

Chromosome

chr17

Gene Name

lnc-RASD1-1

Start

17443322

CPC Label

noncoding

End

17446223

Cancer

OV

Strand

-

Peptide

LEGSGTISAHCNLR

Modified Peptide

n[145]LEGSGTISAHCNLR

Peptide Length

14

ORF Length

54

Open Reading Frame (ORF)

LIFFFTLFPRLEGSGTISAHCNLRLLGSNDSPTSASRVAGITGMCHHARLILYF

Conservation Score

0.055

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.36647

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.977

PhyloCSF Frame 3

0

CNTI Score

-0.324858669