McDonnell Genome Institute

Washington University

Transcript

lnc-RASA1-28:1

Chromosome

chr5

Gene Name

lnc-RASA1-28

Start

88141821

CPC Label

noncoding

End

88142437

Cancer

EOGC

Strand

+

Peptide

EYICNVWIVEK

Modified Peptide

n[145]EYICNVWIVEK

Peptide Length

11

ORF Length

61

Open Reading Frame (ORF)

LALPHLLRKMNTPFSSISFMGDHFSFQIITSINILRGIKKALCQKIREYICNVWIVEKDNT

Conservation Score

1

PhyloCSF Frame 1

-2.154

No. of Spectra

34

CPC Coding Probability

0.0241169

PhyloCSF Frame 2 

1.171

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-2.624

CNTI Score

-0.477310482