McDonnell Genome Institute

Washington University

Transcript

lnc-RARRES2-2:3

Chromosome

chr7

Gene Name

lnc-RARRES2-2

Start

150362626

CPC Label

noncoding

End

150368751

Cancer

OV

Strand

-

Peptide

GATAEVAVGAR

Modified Peptide

n[145]GATAEVAVGAR

Peptide Length

11

ORF Length

96

Open Reading Frame (ORF)

LEGPSFRFVPKWSTKRPDPANFEKASLHSFLEIKKEQKLLGFLWLRAKRGATAEVAVGARGAFRLERLSSLCGVCGGRCEPVPMTHPLAGGPGFPN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0941425

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9918

PhyloCSF Frame 3

0.219

CNTI Score

-0.277353716