McDonnell Genome Institute

Washington University

Transcript

lnc-RARRES1-4:1

Chromosome

chr3

Gene Name

lnc-RARRES1-4

Start

159386755

CPC Label

noncoding

End

159387440

Cancer

BRCA-Basal-like

Strand

-

Peptide

SLHEEFTDHLVK

Modified Peptide

n[145]SLHEEFTDHLVK

Peptide Length

12

ORF Length

70

Open Reading Frame (ORF)

LLHLDQGCTATLGNFTKATFDAISKTYSYLMPDLWKETVAKSLHEEFTDHLVKTTQVSTHRTQVLAMAMT

Conservation Score

1

PhyloCSF Frame 1

-4.581

No. of Spectra

2

CPC Coding Probability

0.0618522

PhyloCSF Frame 2 

-2.996

CNTI Index

noncoding

Max Probability

0.669

PhyloCSF Frame 3

-3.423

CNTI Score

-0.36285392