McDonnell Genome Institute

Washington University

Transcript

lnc-RARRES1-3:2

Chromosome

chr3

Gene Name

lnc-RARRES1-3

Start

158794928

CPC Label

noncoding

End

158802013

Cancer

EOGC

Strand

-

Peptide

LVCQGIMSQPSIFELK

Modified Peptide

n[145]LVCQGIMSQPSIFELK

Peptide Length

16

ORF Length

73

Open Reading Frame (ORF)

LVCQGIMSQPSIFELKETKLGQAPWFTPGNPTLWEAEVGILLILRNWRPAWATWRNLISPKIQNLARCGDMRL

Conservation Score

0.291

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.321403

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9688

PhyloCSF Frame 3

0

CNTI Score

0.651681721