McDonnell Genome Institute

Washington University

Transcript

lnc-RARRES1-2:5

Chromosome

chr3

Gene Name

lnc-RARRES1-2

Start

158772365

CPC Label

noncoding

End

158792827

Cancer

OV

Strand

-

Peptide

GAAYISSAASLAVDMVLGEPKRADCWK

Modified Peptide

n[145]GAAYISSAASLAVDM[147]VLGEPKRADCWK

Peptide Length

27

ORF Length

102

Open Reading Frame (ORF)

LGRVGRGSHTANKRQRPGVFGPGCKLWSCHFLSEGPCHPDGEKQACNRRKERQELGGCDKGAAYISSAASLAVDMVLGEPKRADCWKRVEENIFSLRNITGL

Conservation Score

0.056

PhyloCSF Frame 1

-4.459

No. of Spectra

12

CPC Coding Probability

0.108612

PhyloCSF Frame 2 

-1.583

CNTI Index

noncoding

Max Probability

0.7341

PhyloCSF Frame 3

-4.58

CNTI Score

-0.340861714